CYTL1 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P8535
| Article Name: |
CYTL1 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P8535 |
| Supplier Catalog Number: |
P8535 |
| Alternative Catalog Number: |
ABN-P8535-2 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human CYTL1 (Q9NRR1, 23 a.a.- 136 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli. |
| Tag: |
His-Tag |
| UniProt: |
54360 |
| Buffer: |
CYTL1 was filtered (0.4 um) and lyophilized from 0.5mg/ml in 20mM Tris buffer and 50mM NaCl, pH 7.5. |
| Form: |
Lyophilized |
| Sequence: |
MKHHHHHHASTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCVLDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR. |
| Target: |
CYTL1 |
