DEFB116 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P8536
| Article Name: |
DEFB116 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P8536 |
| Supplier Catalog Number: |
P8536 |
| Alternative Catalog Number: |
ABN-P8536-2 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human DEFB116 (Q30KQ4, 24 a.a.- 102 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli. |
| Tag: |
His-Tag |
| UniProt: |
245930 |
| Buffer: |
DEFB116 protein solution (0.5mg/ml) containing 20mM Tris-HCl buffer (pH8.0), 10% glycerol and 0.4M Urea. |
| Form: |
Liquid |
| Sequence: |
MGSSHHHHHHSSGLVPRGSHMGSGLFRSHNGKSREPWNPCELYQGMCRNACREYEIQYLTCPNDQKCCLKLSVKITSSKNVKEDYDSNSNLSVTNSSSYSHI. |
| Target: |
DEFB116 |
