DEFB118 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P8537
| Article Name: |
DEFB118 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P8537 |
| Supplier Catalog Number: |
P8537 |
| Alternative Catalog Number: |
ABN-P8537-20 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human DEFB118 (Q96PH6, 21 a.a.- 123 a.a.) partial-length recombinant protein with His-tag at N-terminal expressed in Escherichia coli. |
| Tag: |
His-Tag |
| UniProt: |
117285 |
| Buffer: |
20mM Tris-HCl buffer (pH8.0), 0.15M NaCl, 20% glycerol and 1mM DTT. |
| Form: |
Liquid |
| Sequence: |
MGSSHHHHHHSSGLVPRGSHMGSYSGEKKCWNRSGHCRKQCKDGEAVKDTCKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVSSKKDMVEESEAGRGTETSLPNVHHSS. |
| Target: |
DEFB118 |
