FGF4 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P8600
Article Name: FGF4 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8600
Supplier Catalog Number: P8600
Alternative Catalog Number: ABN-P8600-25
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA
Species Reactivity: Human
Human FGF4 recombinant protein expressed in?Escherichia coli.
UniProt: 2249
Buffer: Lyophilized from a solution containing 2X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Form: Lyophilized
Sequence: GRGGAAAPTAPNGTLEAELERRWESLVALSLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Target: FGF4