Fgf9 (Rat) Recombinant Protein, E. coli

Product Overview

• Article Name: Fgf9 (Rat) Recombinant Protein, E. coli
• Biozol Catalog Number: ABN-P8609
• Supplier Catalog Number: P8609
• Alternative Catalog Number: ABN-P8609-2
• Manufacturer: Abnova
• Host: E. coli
• Category: Proteine/Peptide
• Application: FA
• Species Reactivity: Rat

Product Description

Rat Fgf9 recombinant protein expressed in?Escherichia coli.

Product Properties

• UniProt: 25444
• Buffer: Protein(1 mg/mL) was lyophilized from a solution containing 10mM NaP, pH 7.5, 75mM Ammonium Sulfate. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
• Form: Lyophilized
• Sequence: MPLGEVGSYFGVQDAVPFGNVPVLPVDSPVLLNDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS
• Target: Fgf9