FGF12 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P8610
| Article Name: |
FGF12 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P8610 |
| Supplier Catalog Number: |
P8610 |
| Alternative Catalog Number: |
ABN-P8610-2 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Species Reactivity: |
Human |
| Human FGF12 recombinant protein expressed in?Escherichia coli. |
| UniProt: |
2257 |
| Buffer: |
Lyophilized from a solution containing 1X PBS, pH7.4, 1mM DTT. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
MESKEPQLKGIVTRLFSQQGYFLQMHPDGTIDGTKDENSDYTLFNLIPVGLRVVAIQGVKASLYVAMNGEGYLYSSDVFTPECKFKESVFENYYVIYSSTLYRQQESGRAWFLGLNKEGQIMKGNRVKKTKPSSHFVPKPIEVCMYREQSLHEIGEKQGRSRKSSGTPTMNGGKVVNQDST |
| Target: |
FGF12 |
