HGF (Human) Recombinant Protein, Insect
Catalog Number:
ABN-P8759
| Article Name: |
HGF (Human) Recombinant Protein, Insect |
| Biozol Catalog Number: |
ABN-P8759 |
| Supplier Catalog Number: |
P8759 |
| Alternative Catalog Number: |
ABN-P8759-2 |
| Manufacturer: |
Abnova |
| Host: |
Insect |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Species Reactivity: |
Human |
| Human HGF recombinant protein expressed in Insect cells. |
| UniProt: |
3082 |
| Buffer: |
Protein (1 mg/mL) was lyophilized from a solution containing 50 mM acetic acid. Reconstitute the lyophilized powder in 50 mM acetic acid to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
QRKRRNTIHEFKKSAKTTLIKIDPALKIKTKKVNTADQCANRCTRNKGLPFTCKAFVFDKARKQCLWFPFNSMSSGVKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIPHEHSYRGKDLQENYCRNPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDGQPRPWCYTLDPHTRWEYCAIKTCAD |
| Target: |
HGF |
