Mif (Mouse) Recombinant Protein, E. coli
Catalog Number:
ABN-P8935
| Article Name: |
Mif (Mouse) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P8935 |
| Supplier Catalog Number: |
P8935 |
| Alternative Catalog Number: |
ABN-P8935-20 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Mouse |
| Mouse Mif (P34884, 1 a.a. - 115 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli. |
| Tag: |
His tag |
| UniProt: |
17319 |
| Buffer: |
Phosphate buffered saline , 10% glycerol and 1mM DTT. |
| Form: |
Liquid |
| Sequence: |
MGSSHHHHHHSSGLVPRGSHMGSMPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA. |
| Target: |
Mif |
