NRG4 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P8963
| Article Name: |
NRG4 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P8963 |
| Supplier Catalog Number: |
P8963 |
| Alternative Catalog Number: |
ABN-P8963-2 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human NRG4 (Q8WWG1, 1 a.a. - 61 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli. |
| Tag: |
His tag |
| UniProt: |
145957 |
| Buffer: |
20mM Tris-HCl(pH8.0), 30% glycerol, 0.15M NaCl and 1mM DTT. |
| Form: |
Liquid |
| Sequence: |
MGSSHHHHHHSSGLVPRGSHMGSMPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNL. |
| Target: |
NRG4 |
