NRN1 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P8966
| Article Name: |
NRN1 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P8966 |
| Supplier Catalog Number: |
P8966 |
| Alternative Catalog Number: |
ABN-P8966-2 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human NRN1 (Q9NPD7, 28 a.a. - 116 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli. |
| Tag: |
His tag |
| UniProt: |
51299 |
| Buffer: |
Lyophilized from 20mM Tris buffer, 50mM NaCl, pH 8.0, 1% (w/v) Sucrose and 4% (w/v) Mannitol. |
| Form: |
Lyophilized |
| Sequence: |
MKHHHHHHASAGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNG. |
| Target: |
NRN1 |
