NRP1 (Human) Recombinant Protein, Virus
Catalog Number:
ABN-P8967
| Article Name: |
NRP1 (Human) Recombinant Protein, Virus |
| Biozol Catalog Number: |
ABN-P8967 |
| Supplier Catalog Number: |
P8967 |
| Alternative Catalog Number: |
ABN-P8967-2 |
| Manufacturer: |
Abnova |
| Host: |
Virus |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human NRP1 (Q58F21, 22 a.a. - 856 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus. |
| Tag: |
His tag |
| UniProt: |
8829 |
| Buffer: |
phosphate buffered saline (pH7.4) and 20% glycerol. |
| Form: |
Liquid |
| Sequence: |
FRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEVYGCKITDYPCSGML |
| Target: |
NRP1 |
