NPPA (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P8980
Article Name: NPPA (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P8980
Supplier Catalog Number: P8980
Alternative Catalog Number: ABN-P8980-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human NPPA (P01160, 26 a.a. - 123 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.
Tag: His tag
UniProt: 4878
Buffer: Lyophilized from 20 mM Tris buffer, 50 mM NaCl and 5% w/v trehalosa, pH 7.5.
Form: Lyophilized
Sequence: MKHHHHHHNPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR.
Target: NPPA