NPPA (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P8980
Article Name: |
NPPA (Human) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P8980 |
Supplier Catalog Number: |
P8980 |
Alternative Catalog Number: |
ABN-P8980-2 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
SDS-PAGE |
Species Reactivity: |
Human |
Human NPPA (P01160, 26 a.a. - 123 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli. |
Tag: |
His tag |
UniProt: |
4878 |
Buffer: |
Lyophilized from 20 mM Tris buffer, 50 mM NaCl and 5% w/v trehalosa, pH 7.5. |
Form: |
Lyophilized |
Sequence: |
MKHHHHHHNPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPR. |
Target: |
NPPA |