TNFRSF11B (Human) Recombinant Protein, Yeast

Product Overview

• Article Name: TNFRSF11B (Human) Recombinant Protein, Yeast
• Biozol Catalog Number: ABN-P8988
• Supplier Catalog Number: P8988
• Alternative Catalog Number: ABN-P8988-50
• Manufacturer: Abnova
• Host: Yeast
• Category: Proteine/Peptide
• Application: FA, SDS-PAGE
• Species Reactivity: Human

Product Description

Human TNFRSF11B (O00300, 22 a.a. - 201 a.a.) partial-length recombinant protein and 232 residues from the Fc protein of human IgG1 expressed in Pichia pastoris.

Product Properties

• Tag: Fc
• UniProt: 4982
• Buffer: Lyophilized from 20mM PB, pH 6.0, 150mM NaCl and 0.02 % Tween-80.
• Form: Lyophilized
• Sequence: OPG22-201:ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTL|Fc232:EPKSSDKTHTCPPCPAPEFEGAPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPE
• Target: TNFRSF11B