TNFRSF11B (Human) Recombinant Protein, Plant

Catalog Number: ABN-P8991
Article Name: TNFRSF11B (Human) Recombinant Protein, Plant
Biozol Catalog Number: ABN-P8991
Supplier Catalog Number: P8991
Alternative Catalog Number: ABN-P8991-2
Manufacturer: Abnova
Host: Plant
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human TNFRSF11B (O00300, 22 a.a. - 401 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.
Tag: His tag
UniProt: 4982
Buffer: PBS pH-7.4 and 10% glycerol.
Form: Liquid
Sequence: ADPETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQ
Target: TNFRSF11B