OTOR (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9002
Article Name: OTOR (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9002
Supplier Catalog Number: P9002
Alternative Catalog Number: ABN-P9002-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human OTOR (Q9NRC9, 26 a.a. - 128 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.
Tag: His tag
UniProt: 56914
Buffer: Phosphate buffered saline (pH7.4), 30% glycerol and 1mM DTT.
Form: Liquid
Sequence: MGSSHHHHHHSSGLVPRGSHMGSHMLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIYVYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKEVPTTDIDFFCE.
Target: OTOR