PDGFC (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9015
Article Name: PDGFC (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9015
Supplier Catalog Number: P9015
Alternative Catalog Number: ABN-P9015-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human PDGFC (Q9NRA1, 235 a.a. - 345 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli.
Tag: His tag
UniProt: 56034
Buffer: Lyophilized from Acetonitrile and TFA.
Form: Lyophilized
Sequence: MHHHHHHVVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG.
Target: PDGFC