CSH1 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9030
Article Name: CSH1 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9030
Supplier Catalog Number: P9030
Alternative Catalog Number: ABN-P9030-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA, SDS-PAGE
Species Reactivity: Human
Human CSH1 (P0DML2, 27 a.a. - 217 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus.
Tag: His tag
UniProt: 1442
Buffer: Lyophilized from 30% Glycerol and Phosphate-Buffered Saline (pH 7.4).
Form: Liquid
Sequence: VQTVPLSRLFDHAMLQAHRAHQLAIDTYQEFEETYIPKDQKYSFLHDSQTSFCFSDSIPTPSNMEETQQKSNLELLRISLLLIESWLEPVRFLRSMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYSKFDTNSHNHDALLKNYGLLYCFRKDMDKVETFLRMVQCRSVEGSCGFHHHHHH
Target: CSH1