Pgf (Mouse) Recombinant Protein, Plant
Catalog Number:
ABN-P9039
| Article Name: |
Pgf (Mouse) Recombinant Protein, Plant |
| Biozol Catalog Number: |
ABN-P9039 |
| Supplier Catalog Number: |
P9039 |
| Alternative Catalog Number: |
ABN-P9039-2 |
| Manufacturer: |
Abnova |
| Host: |
Plant |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Mouse |
| Mouse Pgf (P49764, 27 a.a. - 158 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus. |
| Tag: |
His tag |
| UniProt: |
18654 |
| Buffer: |
Phosphate Buffered Saline (pH 7.4), 0.1mM PMSF and 10% glycerol. |
| Form: |
Liquid |
| Sequence: |
AGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHPHHHHHH. |
| Target: |
Pgf |
