CD79B (Human) Recombinant Protein, Plant
Catalog Number:
ABN-P9106
| Article Name: |
CD79B (Human) Recombinant Protein, Plant |
| Biozol Catalog Number: |
ABN-P9106 |
| Supplier Catalog Number: |
P9106 |
| Alternative Catalog Number: |
ABN-P9106-2 |
| Manufacturer: |
Abnova |
| Host: |
Plant |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human CD79B (P40259, 29 a.a. - 159 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus. |
| Tag: |
His tag |
| UniProt: |
974 |
| Buffer: |
PBS (pH7.4) and 10% glycerol. |
| Form: |
Liquid |
| Sequence: |
ADPARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDHHHHHH. |
| Target: |
CD79B |
