CD80 (Human) Recombinant Protein, Plant
Catalog Number:
ABN-P9108
| Article Name: |
CD80 (Human) Recombinant Protein, Plant |
| Biozol Catalog Number: |
ABN-P9108 |
| Supplier Catalog Number: |
P9108 |
| Alternative Catalog Number: |
ABN-P9108-5 |
| Manufacturer: |
Abnova |
| Host: |
Plant |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Human |
| Human CD80 (P33681, 35 a.a. - 242 a.a.) partial-length recombinant protein with His tag at C-Terminus expressed in Baculovirus. |
| Tag: |
His tag |
| UniProt: |
941 |
| Buffer: |
PBS (pH7.4) and 10% glycerol. |
| Form: |
Liquid |
| Sequence: |
VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFPDNLEHHHHHH. |
| Target: |
CD80 |
