CD83 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9109
Article Name: |
CD83 (Human) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P9109 |
Supplier Catalog Number: |
P9109 |
Alternative Catalog Number: |
ABN-P9109-2 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
SDS-PAGE |
Species Reactivity: |
Human |
Human CD83 (Q01151, 20 a.a. - 144 a.a.) partial-length recombinant protein with His tag at N-Terminus expressed in Escherichia coli. |
Tag: |
His tag |
UniProt: |
9308 |
Buffer: |
20mM Tris-HCl buffer (pH 8.0), 0.15M NaCl and 30% glycerol. |
Form: |
Liquid |
Sequence: |
MGSSHHHHHHSSGLVPRGSHMGSTPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAE. |
Target: |
CD83 |