Shh (Rat) Recombinant Protein, E. coli
Catalog Number:
ABN-P9135
| Article Name: |
Shh (Rat) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9135 |
| Supplier Catalog Number: |
P9135 |
| Alternative Catalog Number: |
ABN-P9135-100 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
SDS-PAGE |
| Species Reactivity: |
Rat |
| Rat Shh recombinant protein expressed in Escherichia coli. |
| UniProt: |
29499 |
| Buffer: |
Lyophilized from a solution containing 10 mM sodium phosphate, pH 7.5. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
MIIGPGRGFGKRQHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKARIHCSVKAENSVAAKSDG |
| Target: |
Shh |
