Dhh (Mouse) Recombinant Protein, E. coli

Catalog Number: ABN-P9139
Article Name: Dhh (Mouse) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9139
Supplier Catalog Number: P9139
Alternative Catalog Number: ABN-P9139-25
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA
Species Reactivity: Mouse
Mouse Dhh recombinant protein expressed in Escherichia coli.
UniProt: 13363
Buffer: Lyophilized from a solution containing IX PBS, pH7.4, 1 mM DTT, 0.05% Tween 80. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Form: Lyophilized
Sequence: IIGPGRGPVGRRRYVRKQLVPLLYKQFVPSMPERTLGASGPAEGRVTRGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHIHVSVKADNSLAVRAGG
Target: Dhh