TNFRSF11A (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9141
Article Name: TNFRSF11A (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9141
Supplier Catalog Number: P9141
Alternative Catalog Number: ABN-P9141-100
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA
Species Reactivity: Human
Human TNFRSF11A recombinant protein expressed in Escherichia coli.
UniProt: 8792
Buffer: Lyophilized from a solution containing 20 mM Tris-HCl, pH 8.0, 150 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Form: Lyophilized
Sequence: QIAPPCTSEKHYEHLGRCCNKCEPGKYMSSKCTTTSDSVCLPCGPDEYLDSWNEEDKCLLHKVCDTGKALVAVVAGNSTTPRRCACTAGYHWSQDCECCRRNTECAPGLGAQHPLQLNKDTVCKPCLAGYFSDAFSSTDKCRPWTNCTFLGKRVEHHGTEKSDAVCSSSLPARK
Target: TNFRSF11A