Retnla (Mouse) Recombinant Protein, E. coli

Catalog Number: ABN-P9148
Article Name: Retnla (Mouse) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9148
Supplier Catalog Number: P9148
Alternative Catalog Number: ABN-P9148-25
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Mouse
Mouse Retnla recombinant protein expressed in Escherichia coli.
UniProt: 57262
Buffer: Protein (0.5 mg/mL) was lyophilized from a solution containing 10 mM Sodium phosphate buffer, pH 7.5. Reconstitute the lyophilized powder in ddH2O to 0.1 mg/mL.
Form: Lyophilized
Sequence: MDETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS
Target: Retnla