Retnla (Mouse) Recombinant Protein, E. coli

Catalog Number: ABN-P9149
Article Name: Retnla (Mouse) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9149
Supplier Catalog Number: P9149
Alternative Catalog Number: ABN-P9149-25
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Mouse
Mouse Retnla partial recombinant protein with flagTag in N-terminus expressed in Escherichia coli.
Tag: Flag
UniProt: 57262
Buffer: Protein (0.5 mg/mL) was lyophilized from a solution containing 5 mM Tris-HCl, pH 7.5, 25 mM NaCl. Reconstitute the lyophilized powder in ddH2O and let the lyophilized pellet dissolve completely.
Form: Lyophilized
Sequence: MKKLLFAIPLVVPFYSHSTMVNTDETIEIIVENKVKELLANPANYPSTVTTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLSLEDYKDDDDK
Target: Retnla