RETNLB (Human) Recombinant Protein, E. coli

Product Overview

• Article Name: RETNLB (Human) Recombinant Protein, E. coli
• Biozol Catalog Number: ABN-P9150
• Supplier Catalog Number: P9150
• Alternative Catalog Number: ABN-P9150-25
• Manufacturer: Abnova
• Host: E. coli
• Category: Proteine/Peptide
• Application: SDS-PAGE
• Species Reactivity: Human

Product Description

Human RETNLB recombinant protein with His tag expressed in Escherichia coli.

Product Properties

• Tag: His
• UniProt: 84666
• Buffer: Protein (0.5 mg/mL) was lyophilized from a solution containing 0.05 M Acetate bufer, pH 4.0. Reconstitute the lyophilized powder in 0.1 M Acetate buffer, pH 4 to 10 ug/mL. In higher concentrations the solubility of this antigen is limited.
• Form: Lyophilized
• Sequence: MGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLTKLRSHHHHHH
• Target: RETNLB