RETNLB (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9151
Article Name: RETNLB (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9151
Supplier Catalog Number: P9151
Alternative Catalog Number: ABN-P9151-25
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human RETNLB recombinant protein expressed in Escherichia coli.
UniProt: 84666
Buffer: Lyophilized from a solution containing 0.1% TFA. Reconstitute the lyophilized powder in 0.1% TFA to 100 ug/mL.
Form: Lyophilized
Sequence: MQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Target: RETNLB