Retnlg (Mouse) Recombinant Protein, E. coli

Product Overview

• Article Name: Retnlg (Mouse) Recombinant Protein, E. coli
• Biozol Catalog Number: ABN-P9154
• Supplier Catalog Number: P9154
• Alternative Catalog Number: ABN-P9154-25
• Manufacturer: Abnova
• Host: E. coli
• Category: Proteine/Peptide
• Application: SDS-PAGE
• Species Reactivity: Mouse

Product Description

Mouse Retnlg recombinant protein with His tag expressed in Escherichia coli.

Product Properties

• Tag: His
• UniProt: 245195
• Buffer: Protein (0.5 mg/mL) was lyophilized from a solution containing 0.05 M Acetate buffer,pH 4.0. Reconstitute the lyophilized powder in 0.1 M Acetate buffer, pH 4 to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In
• Form: Lyophilized
• Sequence: MRGSHHHHHHGMASHMTLESIVEKKVKELLANRDDCPSTVTKTFSCTSITASGRLASCPSGMTVTGCACGYGCGSWDIRDGNTCHCQCSTMDWATARCCQLA
• Target: Retnlg