RETN (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9156
Article Name: RETN (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9156
Supplier Catalog Number: P9156
Alternative Catalog Number: ABN-P9156-25
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human RETN recombinant protein expressed in Escherichia coli.
UniProt: 56729
Buffer: Lyophilized from a solution containing 0.1% TFA. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Form: Lyophilized
Sequence: MSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Target: RETN