RETN (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9159
Article Name: RETN (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9159
Supplier Catalog Number: P9159
Alternative Catalog Number: ABN-P9159-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human RETN recombinant protein expressed in Escherichia coli.
UniProt: 56729
Buffer: Protein (1 mg/mL) was lyophilized from a solution containing 0.1% TFA. Add 0.2 ml of ddH2O and let the lyophilized pellet dissolve completely.
Form: Lyophilized
Sequence: MSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP
Target: RETN