Retn (Rat) Recombinant Protein, E. coli

Product Overview

• Article Name: Retn (Rat) Recombinant Protein, E. coli
• Biozol Catalog Number: ABN-P9163
• Supplier Catalog Number: P9163
• Alternative Catalog Number: ABN-P9163-25
• Manufacturer: Abnova
• Host: E. coli
• Category: Proteine/Peptide
• Application: SDS-PAGE
• Species Reactivity: Rat

Product Description

Rat Retn recombinant protein with His tag in N-terminus expressed in Escherichia coli.

Product Properties

• Tag: His
• UniProt: 246250
• Buffer: Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 8.0. Reconstitute the lyophilized powder in ddH2O to 0.5mg/mL and let the lyophilized pellet dissolve completely, and is not sterile! Please filter the product b
• Form: Lyophilized
• Sequence: MRGSHHHHHHGMASHMPSMSLCPMDEAISKKINQDFSSLLPAAMKNTVLHCWSVSSRGRLASCPEGTTVTSCSCGSGCGSWDVREDTMCHCQCGSIDWTAARCCTLRVGS
• Target: Retn