SAA1 (Human) Recombinant Protein, E. coli

Product Overview

• Article Name: SAA1 (Human) Recombinant Protein, E. coli
• Biozol Catalog Number: ABN-P9173
• Supplier Catalog Number: P9173
• Alternative Catalog Number: ABN-P9173-50
• Manufacturer: Abnova
• Host: E. coli
• Category: Proteine/Peptide
• Application: FA
• Species Reactivity: Human

Product Description

Human SAA1 recombinant protein expressed in Escherichia coli.

Product Properties

• UniProt: 6288
• Buffer: Protein (1 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 9.0,150 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
• Form: Lyophilized
• Sequence: RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISNARENIQRFFGRGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
• Target: SAA1