TAFA2 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9193
| Article Name: |
TAFA2 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9193 |
| Supplier Catalog Number: |
P9193 |
| Alternative Catalog Number: |
ABN-P9193-20 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Species Reactivity: |
Human |
| Human TAFA2 recombinant protein expressed in Escherichia coli. |
| UniProt: |
338811 |
| Buffer: |
Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
ANHHKAHHVKTGTCEVVALHRCCNKNKIEERSQTVKCSCFPGQVAGTTRAAPSCVDASIVEQKWWCHMQPCLEGEECKVLPDRKGWSCSSGNKVKTTRVTH |
| Target: |
FAM19A2 |
