TFF1 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9194
| Article Name: |
TFF1 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9194 |
| Supplier Catalog Number: |
P9194 |
| Alternative Catalog Number: |
ABN-P9194-20 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Species Reactivity: |
Human |
| Human TFF1 recombinant proteind expressed in Escherichia coli.. |
| UniProt: |
7031 |
| Buffer: |
Lyophilized from a solution containing 20 mM PB, pH 7.4, 150 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF. |
| Target: |
TFF1 |
