TFF1 (Human) Recombinant Protein, E. coli

Product Overview

• Article Name: TFF1 (Human) Recombinant Protein, E. coli
• Biozol Catalog Number: ABN-P9195
• Supplier Catalog Number: P9195
• Alternative Catalog Number: ABN-P9195-20
• Manufacturer: Abnova
• Host: E. coli
• Category: Proteine/Peptide
• Application: SDS-PAGE
• Species Reactivity: Human

Product Description

Human TFF1 partial recombinant protein with His tag expressed in Escherichia coli.

Product Properties

• Tag: His
• UniProt: 7031
• Buffer: Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 7.5, 20 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In high
• Form: Lyophilized
• Sequence: MKHHHHHHASEAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF
• Target: TFF1