TFF2 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9197
Article Name: TFF2 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9197
Supplier Catalog Number: P9197
Alternative Catalog Number: ABN-P9197-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Human
Human TFF2 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 7032
Buffer: Protein(0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 7.5, 20 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In highe
Form: Lyophilized
Sequence: MKHHHHHHASEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
Target: TFF2