TFF3 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9198
Article Name: TFF3 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9198
Supplier Catalog Number: P9198
Alternative Catalog Number: ABN-P9198-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA
Species Reactivity: Human
Human TFF3 recombinant protein expressed in Escherichia coli.
UniProt: 7033
Buffer: Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Form: Lyophilized
Sequence: EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Target: TFF3