TFF3 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9198
Article Name: |
TFF3 (Human) Recombinant Protein, E. coli |
Biozol Catalog Number: |
ABN-P9198 |
Supplier Catalog Number: |
P9198 |
Alternative Catalog Number: |
ABN-P9198-20 |
Manufacturer: |
Abnova |
Host: |
E. coli |
Category: |
Proteine/Peptide |
Application: |
FA |
Species Reactivity: |
Human |
Human TFF3 recombinant protein expressed in Escherichia coli. |
UniProt: |
7033 |
Buffer: |
Lyophilized from a solution containing 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
Form: |
Lyophilized |
Sequence: |
EEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF |
Target: |
TFF3 |