TFF3 (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9199
Article Name: TFF3 (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9199
Supplier Catalog Number: P9199
Alternative Catalog Number: ABN-P9199-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: FA
Species Reactivity: Human
Human TFF3 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli.
Tag: His
UniProt: 7033
Buffer: Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 7.5, 150 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In hig
Form: Lyophilized
Sequence: MKHHHHHHASEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
Target: TFF3