Tff3 (Rat) Recombinant Protein, E. coli

Catalog Number: ABN-P9200
Article Name: Tff3 (Rat) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9200
Supplier Catalog Number: P9200
Alternative Catalog Number: ABN-P9200-2
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Rat
Rat Tff3 recombinant protein with Flag tag in C-terminus expressed in Escherichia coli.
Tag: Flag
UniProt: 25563
Buffer: Protein (0.5 mg/mL) was lyophilized from a solution containing 20 mM Tris-HCl, pH 7.5, 50 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 0.5mg/mL, and is not sterile! Please filter the product by an sterile filter before use. In high
Form: Lyophilized
Sequence: MQEFVGLSPSQCMVPANVRVDCGYPTVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTFDYKDDDDK
Target: Tff3