TGFB1 (Human) Recombinant Protein, Mammal

Product Overview

• Article Name: TGFB1 (Human) Recombinant Protein, Mammal
• Biozol Catalog Number: ABN-P9202
• Supplier Catalog Number: P9202
• Alternative Catalog Number: ABN-P9202-2
• Manufacturer: Abnova
• Host: Mammal
• Category: Proteine/Peptide
• Application: FA
• Species Reactivity: Human

Product Description

Human TGFB1 recombinant protein expressed in CHO cells.

Product Properties

• UniProt: 7040
• Buffer: Lyophilized from a solution containing 0.1% TFA and trehalose (1:20 protein to Trehalose ratio). Reconstitute the lyophilized powder in 10 mM HCl to 0.1 mg/mL.
• Form: Lyophilized
• Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
• Target: TGFB1