TGFB2 (Human) Recombinant Protein, Plant
Catalog Number:
ABN-P9207
| Article Name: |
TGFB2 (Human) Recombinant Protein, Plant |
| Biozol Catalog Number: |
ABN-P9207 |
| Supplier Catalog Number: |
P9207 |
| Alternative Catalog Number: |
ABN-P9207-5 |
| Manufacturer: |
Abnova |
| Host: |
Plant |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Species Reactivity: |
Human |
| Human TGFB2 recombinant protein with His tag in N-terminus expressed in Nicotiana benthamiana. |
| Tag: |
His |
| UniProt: |
7042 |
| Buffer: |
Protein (1 mg/mL) was lyophilized from a solution containing 50 mM Tris-HCl, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS |
| Target: |
TGFB2 |
