Tnf (Rat) Recombinant Protein, E. coli

Product Overview

• Article Name: Tnf (Rat) Recombinant Protein, E. coli
• Biozol Catalog Number: ABN-P9227
• Supplier Catalog Number: P9227
• Alternative Catalog Number: ABN-P9227-20
• Manufacturer: Abnova
• Host: E. coli
• Category: Proteine/Peptide
• Application: FA
• Species Reactivity: Rat

Product Description

Rat Tnf recombinant protein expressed in Escherichia coli.

Product Properties

• UniProt: 24835
• Buffer: Protein (1 mg/mL) was lyophilized from a solution containing 20 mM phosphate buffer, 0.1 M NaCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
• Form: Lyophilized
• Sequence: MLRSSSQNSSDKPVVHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFATSYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVSQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
• Target: Tnf