TNF (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9234
| Article Name: |
TNF (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9234 |
| Supplier Catalog Number: |
P9234 |
| Alternative Catalog Number: |
ABN-P9234-50 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Species Reactivity: |
Human |
| Human TNF recombinant protein expressed in Escherichia coli. |
| UniProt: |
7124 |
| Buffer: |
The protein after extensive dialysis against was lyophilized in 0.5X PBS, pH 7.0. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
MRKRKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAF. |
| Target: |
TNF |
