LTA (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9236
| Article Name: |
LTA (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9236 |
| Supplier Catalog Number: |
P9236 |
| Alternative Catalog Number: |
ABN-P9236-20 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Species Reactivity: |
Human |
| Human LTA recombinant protein expressed in Escherichia coli. |
| UniProt: |
4049 |
| Buffer: |
Protein was lyophilized with no additives. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
MLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL. |
| Target: |
LTA |
