TNFRSF1A (Human) Recombinant Protein, E. coli

Catalog Number: ABN-P9239
Article Name: TNFRSF1A (Human) Recombinant Protein, E. coli
Biozol Catalog Number: ABN-P9239
Supplier Catalog Number: P9239
Alternative Catalog Number: ABN-P9239-20
Manufacturer: Abnova
Host: E. coli
Category: Proteine/Peptide
Application: SDS-PAGE
Species Reactivity: Mouse
Human TNFRSF1A recombinant protein expressed in Escherichia coli.
UniProt: 7132
Buffer: Lyophilized from a solution containing 10 mM sodium phosphate buffer, pH 7.5. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
Form: Lyophilized
Sequence: MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESSGSFTASENHLRHCLSCSKCRKEMGQVEKSSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN.
Target: TNFRSF1A