TNFRSF10B (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9262
| Article Name: |
TNFRSF10B (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9262 |
| Supplier Catalog Number: |
P9262 |
| Alternative Catalog Number: |
ABN-P9262-50 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Species Reactivity: |
Human |
| Human TNFRSF10B recombinant protein expressed in Escherichia coli. |
| UniProt: |
8795 |
| Buffer: |
Lyophilized from 1X PBS, pH 7.4. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
ESALITQQDLAPQQRVAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVHKES |
| Target: |
TNFRSF10B |
