TNFSF12 (Human) Recombinant Protein, E. coli
Catalog Number:
ABN-P9266
| Article Name: |
TNFSF12 (Human) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9266 |
| Supplier Catalog Number: |
P9266 |
| Alternative Catalog Number: |
ABN-P9266-25 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Species Reactivity: |
Human |
| Human TNFSF12 partial recombinant protein with His tag in N-terminus expressed in Escherichia coli. |
| Tag: |
His |
| UniProt: |
8742 |
| Buffer: |
Lyophilized from 1X PBS. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
MHHHHHHRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
| Target: |
TNFSF12 |
