Tnfsf14 (Mouse) Recombinant Protein, E. coli
Catalog Number:
ABN-P9273
| Article Name: |
Tnfsf14 (Mouse) Recombinant Protein, E. coli |
| Biozol Catalog Number: |
ABN-P9273 |
| Supplier Catalog Number: |
P9273 |
| Alternative Catalog Number: |
ABN-P9273-20 |
| Manufacturer: |
Abnova |
| Host: |
E. coli |
| Category: |
Proteine/Peptide |
| Application: |
FA |
| Species Reactivity: |
Mouse |
| Mouse Tnfsf14 recombinant proteind expressed in Escherichia coli. |
| UniProt: |
50930 |
| Buffer: |
Lyophilized from 1X PBS, pH 7.4. Reconstitute the lyophilized powder in sterile 100 mM HAc to 100 ug/mL. |
| Form: |
Lyophilized |
| Sequence: |
DGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV |
| Target: |
Tnfsf14 |
