TNFRSF17 (Human) Recombinant Protein, E. coli

Product Overview

• Article Name: TNFRSF17 (Human) Recombinant Protein, E. coli
• Biozol Catalog Number: ABN-P9275
• Supplier Catalog Number: P9275
• Alternative Catalog Number: ABN-P9275-20
• Manufacturer: Abnova
• Host: E. coli
• Category: Proteine/Peptide
• Application: SDS-PAGE
• Species Reactivity: Human

Product Description

Human TNFRSF17 recombinant protein expressed in Escherichia coli.

Product Properties

• UniProt: 608
• Buffer: 1 mg protein lyophilized from a solution containing 20 mM sodium phosphate buffer, pH 7.4, 130 mM NaCl. Reconstitute the lyophilized powder in ddH2O to 100 ug/mL.
• Form: Lyophilized
• Sequence: AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
• Target: TNFRSF17